SCOPe 2.01: Domain d3bvsa_: 3bvs A:

Lineage for d3bvsa_ (3bvs A:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (24 families)

5. Family a.118.1.0: automated matches [191340] (1 protein)
   not a true family

6. Protein automated matches [190220] (4 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [188492] (1 PDB entry)

8. Domain d3bvsa_: 3bvs A: [172871]
   automated match to d2b6ca1

Details for d3bvsa_

PDB Entry: 3bvs, 2.1 Å

PDB Description: Crystal Structure of Bacillus cereus Alkylpurine DNA Glycosylase AlkD

PDB Compounds: (A:) Alkylpurine DNA Glycosylase AlkD

SCOPe Domain Sequences for d3bvsa_:

Sequence; same for both SEQRES and ATOM records:

>d3bvsa_ a.118.1.0 (A:) automated matches {Bacillus cereus [TaxId: 1396]}
vpmhpfvkalqehftahqnpekaepmarymknhflflgiqtperrqllkdiiqihtlpdq
kdfqiiirelwdlperefqaaaldimqkykkhinethipfleelivtkswwdsvdsivpt
flgdiflkhpelisayipkwiasdniwlqraailfqlkykqkmdeellfwiigqlhsske
ffiqkaigwvlreyaktnpdvvweyvqnnelaplskreaikhikqny

Timeline for d3bvsa_:

• d3bvsa_ is new in SCOPe 2.01-stable
  
• d3bvsa_ appears in SCOPe 2.02
  
• d3bvsa_ appears in the current release, SCOPe 2.08, called d3bvsa1