SCOPe 2.08: Domain d3bvsa1: 3bvs A:1-225

Lineage for d3bvsa1 (3bvs A:1-225)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (28 families)

5. Family a.118.1.0: automated matches [191340] (1 protein)
   not a true family

6. Protein automated matches [190220] (14 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [188492] (1 PDB entry)

8. Domain d3bvsa1: 3bvs A:1-225 [172871]
   Other proteins in same PDB: d3bvsa2
   automated match to d2b6ca1

Details for d3bvsa1

PDB Entry: 3bvs, 2.1 Å

PDB Description: Crystal Structure of Bacillus cereus Alkylpurine DNA Glycosylase AlkD

PDB Compounds: (A:) Alkylpurine DNA Glycosylase AlkD

SCOPe Domain Sequences for d3bvsa1:

Sequence; same for both SEQRES and ATOM records:

>d3bvsa1 a.118.1.0 (A:1-225) automated matches {Bacillus cereus [TaxId: 1396]}
mhpfvkalqehftahqnpekaepmarymknhflflgiqtperrqllkdiiqihtlpdqkd
fqiiirelwdlperefqaaaldimqkykkhinethipfleelivtkswwdsvdsivptfl
gdiflkhpelisayipkwiasdniwlqraailfqlkykqkmdeellfwiigqlhsskeff
iqkaigwvlreyaktnpdvvweyvqnnelaplskreaikhikqny

Timeline for d3bvsa1:

• d3bvsa1 first appeared in SCOPe 2.01, called d3bvsa_
  
• d3bvsa1 appears in SCOPe 2.07