Class a: All alpha proteins [46456] (218 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (10 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (23 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (10 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [47520] (1 PDB entry) mutant with a two residue deletion in the central helix |
Domain d1ahr__: 1ahr - [17287] |
PDB Entry: 1ahr (more details), 1.8 Å
SCOP Domain Sequences for d1ahr__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ahr__ a.39.1.5 (-) Calmodulin {Chicken (Gallus gallus)} adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn gtidfpefltmmarkmkdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevd emireadidgdgqvnyeefvtmmtsk
Timeline for d1ahr__: