Lineage for d1ahr__ (1ahr -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 3180Fold a.39: EF Hand-like [47472] (3 superfamilies)
  4. 3181Superfamily a.39.1: EF-hand [47473] (7 families) (S)
  5. 3288Family a.39.1.5: Calmodulin-like [47502] (13 proteins)
  6. 3306Protein Calmodulin [47516] (7 species)
  7. 3316Species Chicken (Gallus gallus) [TaxId:9031] [47520] (1 PDB entry)
  8. 3317Domain d1ahr__: 1ahr - [17287]

Details for d1ahr__

PDB Entry: 1ahr (more details), 1.8 Å

PDB Description: calmodulin mutant with a two residue deletion in the central helix

SCOP Domain Sequences for d1ahr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahr__ a.39.1.5 (-) Calmodulin {Chicken (Gallus gallus)}
adqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgn
gtidfpefltmmarkmkdseeeireafrvfdkdgngfisaaelrhvmtnlgekltdeevd
emireadidgdgqvnyeefvtmmtsk

SCOP Domain Coordinates for d1ahr__:

Click to download the PDB-style file with coordinates for d1ahr__.
(The format of our PDB-style files is described here.)

Timeline for d1ahr__: