| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein automated matches [190041] (27 species) not a true protein |
| Species Helicobacter pylori [TaxId:210] [188725] (5 PDB entries) |
| Domain d3bvle1: 3bvl E:1-166 [172867] Other proteins in same PDB: d3bvla2, d3bvlb2, d3bvlc2, d3bvld2, d3bvle2, d3bvlf2 automated match to d1krqa_ complexed with fe, gol |
PDB Entry: 3bvl (more details), 1.8 Å
SCOPe Domain Sequences for d3bvle1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bvle1 a.25.1.1 (E:1-166) automated matches {Helicobacter pylori [TaxId: 210]}
mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakkliif
lnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnfl
qwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
Timeline for d3bvle1: