Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d3bvlc_ (3bvl C:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. Protein automated matches [190041] (18 species)
    not a true protein
  7. Species Helicobacter pylori [TaxId:210] [188725] (5 PDB entries)
  8. Domain d3bvlc_: 3bvl C: [172865]
    automated match to d1krqa_
    complexed with fe, gol

Details for d3bvlc_

PDB Entry: 3bvl (more details)
PDB Description: structural basis for the iron uptake mechanism of helicobact ferritin
PDB Compounds: (C:) Ferritin

SCOP Domain Sequences for d3bvlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bvlc_ a.25.1.1 (C:) automated matches {Helicobacter pylori [TaxId: 210]}
hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk

SCOP Domain Coordinates for d3bvlc_:

Click to download the PDB-style file with coordinates for d3bvlc_.
(The format of our PDB-style files is described here.)

Timeline for d3bvlc_:

d3bvlc_ appears in SCOP 1.75A


d3bvlc_
(click for larger image)


d3bvlc_ in context of chain



d3bvlc_ in context of PDB
Domains from other chains:
d3bvla_, d3bvlb_, d3bvld_, d3bvle_, d3bvlf_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu