![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (34 species) not a true protein |
![]() | Species Helicobacter pylori [TaxId:210] [188725] (5 PDB entries) |
![]() | Domain d3bvkc1: 3bvk C:1-166 [172859] Other proteins in same PDB: d3bvka2, d3bvkb2, d3bvkc2, d3bvkd2, d3bvke2, d3bvkf2 automated match to d1krqa_ complexed with fe, gol |
PDB Entry: 3bvk (more details), 1.5 Å
SCOPe Domain Sequences for d3bvkc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bvkc1 a.25.1.1 (C:1-166) automated matches {Helicobacter pylori [TaxId: 210]} mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakkliif lnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnfl qwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
Timeline for d3bvkc1: