SCOPe 2.02: Domain d3bvka_: 3bvk A:

Lineage for d3bvka_ (3bvk A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (21 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [188725] (5 PDB entries)

8. Domain d3bvka_: 3bvk A: [172857]
   automated match to d1krqa_
   complexed with fe, gol

Details for d3bvka_

PDB Entry: 3bvk, 1.5 Å

PDB Description: Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin

PDB Compounds: (A:) Ferritin

SCOPe Domain Sequences for d3bvka_:

Sequence; same for both SEQRES and ATOM records:

>d3bvka_ a.25.1.1 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk

Timeline for d3bvka_:

• d3bvka_ first appeared in SCOPe 2.01
  
• d3bvka_ appears in SCOPe 2.03
  
• d3bvka_ appears in the current release, SCOPe 2.08, called d3bvka1