Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d3bvka_ (3bvk A:)

  1. Root: SCOP 1.75B
  2. Class a: All alpha proteins [46456] (284 folds)
  3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. Protein automated matches [190041] (18 species)
    not a true protein
  7. Species Helicobacter pylori [TaxId:210] [188725] (5 PDB entries)
  8. Domain d3bvka_: 3bvk A: [172857]
    automated match to d1krqa_
    complexed with fe, gol

Details for d3bvka_

PDB Entry: 3bvk (more details)
PDB Description: structural basis for the iron uptake mechanism of helicobact ferritin
PDB Compounds: (A:) Ferritin

SCOP Domain Sequences for d3bvka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bvka_ a.25.1.1 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk

SCOP Domain Coordinates for d3bvka_:

Click to download the PDB-style file with coordinates for d3bvka_.
(The format of our PDB-style files is described here.)

Timeline for d3bvka_:

d3bvka_ appears in SCOP 1.75A


d3bvka_
(click for larger image)


d3bvka_ in context of chain



d3bvka_ in context of PDB
Domains from other chains:
d3bvkb_, d3bvkc_, d3bvkd_, d3bvke_, d3bvkf_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu