| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 protein domains) |
| Protein automated matches [190041] (18 species) not a true protein |
| Species Helicobacter pylori [TaxId:210] [188725] (5 PDB entries) |
| Domain d3bvka_: 3bvk A: [172857] automated match to d1krqa_ complexed with fe, gol |
| PDB Entry: 3bvk (more details) PDB Description: structural basis for the iron uptake mechanism of helicobact ferritin
PDB Compounds: (A:) FerritinSCOP Domain Sequences for d3bvka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bvka_ a.25.1.1 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
SCOP Domain Coordinates for d3bvka_:
Click to download the PDB-style file with coordinates for d3bvka_. (The format of our PDB-style files is described here.)
Timeline for d3bvka_:
d3bvka_ appears in SCOP 1.75A | d3bvka_ (click for larger image) d3bvka_ in context of chain d3bvka_ in context of PDB Domains from other chains: d3bvkb_, d3bvkc_, d3bvkd_, d3bvke_, d3bvkf_ |
|
|
Copyright © 1994-2013 The SCOP
and Astral authors scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu |