Lineage for d3bvia_ (3bvi A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1727565Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1728504Protein automated matches [190041] (24 species)
    not a true protein
  7. 1728708Species Helicobacter pylori [TaxId:210] [188725] (5 PDB entries)
  8. 1728733Domain d3bvia_: 3bvi A: [172851]
    automated match to d1krqa_
    complexed with fe, gol

Details for d3bvia_

PDB Entry: 3bvi (more details), 2 Å

PDB Description: Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
PDB Compounds: (A:) Ferritin

SCOPe Domain Sequences for d3bvia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bvia_ a.25.1.1 (A:) automated matches {Helicobacter pylori [TaxId: 210]}
hhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeha
kkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdh
atfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk

SCOPe Domain Coordinates for d3bvia_:

Click to download the PDB-style file with coordinates for d3bvia_.
(The format of our PDB-style files is described here.)

Timeline for d3bvia_: