| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.1: Ferritin [47241] (10 proteins) |
| Protein automated matches [190041] (34 species) not a true protein |
| Species Helicobacter pylori [TaxId:210] [188725] (5 PDB entries) |
| Domain d3bvfe1: 3bvf E:1-166 [172849] Other proteins in same PDB: d3bvfa2, d3bvfb2, d3bvfc2, d3bvfd2, d3bvfe2, d3bvff2 automated match to d1krqa_ complexed with fe, gol, ipa |
PDB Entry: 3bvf (more details), 1.5 Å
SCOPe Domain Sequences for d3bvfe1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bvfe1 a.25.1.1 (E:1-166) automated matches {Helicobacter pylori [TaxId: 210]}
mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakkliif
lnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnfl
qwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk
Timeline for d3bvfe1: