SCOPe 2.06: Domain d3bvfd1: 3bvf D:1-166

Lineage for d3bvfd1 (3bvf D:1-166)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein automated matches [190041] (27 species)
   not a true protein

7. Species Helicobacter pylori [TaxId:210] [188725] (5 PDB entries)

8. Domain d3bvfd1: 3bvf D:1-166 [172848]
   Other proteins in same PDB: d3bvfa2, d3bvfb2, d3bvfc2, d3bvfd2, d3bvfe2, d3bvff2
   automated match to d1krqa_
   complexed with fe, gol, ipa

Details for d3bvfd1

PDB Entry: 3bvf, 1.5 Å

PDB Description: Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin

PDB Compounds: (D:) Ferritin

SCOPe Domain Sequences for d3bvfd1:

Sequence; same for both SEQRES and ATOM records:

>d3bvfd1 a.25.1.1 (D:1-166) automated matches {Helicobacter pylori [TaxId: 210]}
mlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyehakkliif
lnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskdhatfnfl
qwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk

Timeline for d3bvfd1:

• d3bvfd1 first appeared in SCOPe 2.01, called d3bvfd_
  
• d3bvfd1 was called d3bvfd_ in SCOPe 2.05
  
• d3bvfd1 appears in SCOPe 2.07
  
• d3bvfd1 appears in the current release, SCOPe 2.08