Lineage for d3bveb_ (3bve B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1264123Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1264992Protein automated matches [190041] (22 species)
    not a true protein
  7. 1265161Species Helicobacter pylori [TaxId:210] [188725] (5 PDB entries)
  8. 1265181Domain d3bveb_: 3bve B: [172840]
    automated match to d1krqa_
    complexed with gol

Details for d3bveb_

PDB Entry: 3bve (more details), 1.8 Å

PDB Description: Structural basis for the iron uptake mechanism of Helicobacter pylori ferritin
PDB Compounds: (B:) Ferritin

SCOPe Domain Sequences for d3bveb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bveb_ a.25.1.1 (B:) automated matches {Helicobacter pylori [TaxId: 210]}
hhhsqdpmlskdiikllneqvnkemnssnlymsmsswcythsldgaglflfdhaaeeyeh
akkliiflnennvpvqltsisapehkfegltqifqkayeheqhisesinnivdhaikskd
hatfnflqwyvaeqheeevlfkdildkielignenhglyladqyvkgiaksrk

SCOPe Domain Coordinates for d3bveb_:

Click to download the PDB-style file with coordinates for d3bveb_.
(The format of our PDB-style files is described here.)

Timeline for d3bveb_: