SCOPe 2.07: Domain d3bura_: 3bur A:

Lineage for d3bura_ (3bur A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families)

5. Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
   Common fold covers whole protein structure

6. Protein automated matches [190169] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188399] (47 PDB entries)

8. Domain d3bura_: 3bur A: [172829]
   automated match to d1q13a_
   complexed with gol, nap, tes

Details for d3bura_

PDB Entry: 3bur, 1.62 Å

PDB Description: crystal structure of delta(4)-3-ketosteroid 5-beta-reductase in complex with nadp and testosterone. resolution: 1.62 a.

PDB Compounds: (A:) 3-oxo-5-beta-steroid 4-dehydrogenase

SCOPe Domain Sequences for d3bura_:

Sequence; same for both SEQRES and ATOM records:

>d3bura_ c.1.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlsaashriplsdgnsipiiglgtysepkstpkgacatsvkvaidtgyrhidgayiyqne
hevgeairekiaegkvrredifycgklwatnhvpemvrptlertlrvlqldyvdlyiiev
pmafkpgdeiyprdengkwlyhksnlcatweameackdaglvkslgvsnfnrrqleliln
kpglkhkpvsnqvechpyftqpkllkfcqqhdivitaysplgtsrnpiwvnvssppllkd
allnslgkrynktaaqivlrfniqrgvvvipksfnlerikenfqifdfslteeemkdiea
lnknvrfvellmwrdhpeypfhdey

Timeline for d3bura_:

• d3bura_ first appeared in SCOPe 2.01
  
• d3bura_ appears in SCOPe 2.06
  
• d3bura_ appears in the current release, SCOPe 2.08