Lineage for d3buga_ (3bug A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1320913Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1320914Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1322142Family b.50.1.2: Pepsin-like [50646] (11 proteins)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 1322829Protein automated matches [190156] (4 species)
    not a true protein
  7. 1322854Species Human (Homo sapiens) [TaxId:9606] [187237] (36 PDB entries)
  8. 1322893Domain d3buga_: 3bug A: [172827]
    automated match to d1fkna_
    complexed with aeh

Details for d3buga_

PDB Entry: 3bug (more details), 2.5 Å

PDB Description: BACE-1 complexed with compound 3
PDB Compounds: (A:) Beta-secretase 1

SCOPe Domain Sequences for d3buga_:

Sequence, based on SEQRES records: (download)

>d3buga_ b.50.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
lglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmiigg
idhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpk
kvfeaavasikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfri
tilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsa
chvhdefrtaavegpfvtldmedcgyni

Sequence, based on observed residues (ATOM records): (download)

>d3buga_ b.50.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrqlss
tyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwegi
lglayaeiarpddslepffdslvkqthvpnlfslqlcgsvggsmiiggidhslytgslwy
tpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavasika
asstefpdgfwlgeqlvcwpwnifpvislylmgevtnqsfritilpqqylrpvdcykfai
sqsstgtvmgavimegfyvvfdrarkrigfavsachrtaavegpfvtldmedcgyni

SCOPe Domain Coordinates for d3buga_:

Click to download the PDB-style file with coordinates for d3buga_.
(The format of our PDB-style files is described here.)

Timeline for d3buga_: