Lineage for d3bt8a_ (3bt8 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806997Protein automated matches [190077] (22 species)
    not a true protein
  7. 2807043Species Leishmania donovani [TaxId:5661] [187796] (5 PDB entries)
  8. 2807045Domain d3bt8a_: 3bt8 A: [172825]
    automated match to d1xo7a_
    mutant

Details for d3bt8a_

PDB Entry: 3bt8 (more details), 2.7 Å

PDB Description: crystal structure of mutant cyclophilin (r147a) from leishmania donovani
PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d3bt8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bt8a_ b.62.1.1 (A:) automated matches {Leishmania donovani [TaxId: 5661]}
epevtakvyfdvmidseplgritiglfgkdaplttenfrqlctgehgfgykdsifhrviq
nfmiqggdftnfdgtggksiygekfadenlnvkhfvgalsmanagpntngsqffittapt
pwldgahvvfgkvldgmdvvlriektktnshdrpvkpvkivasgel

SCOPe Domain Coordinates for d3bt8a_:

Click to download the PDB-style file with coordinates for d3bt8a_.
(The format of our PDB-style files is described here.)

Timeline for d3bt8a_: