Lineage for d3bt6a_ (3bt6 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1778087Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 1778088Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 1778135Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 1778136Protein Hemagglutinin [49824] (7 species)
    includes rudiment esterase domain
  7. 1778479Species Influenza b virus [TaxId:11520] [188441] (4 PDB entries)
  8. 1778489Domain d3bt6a_: 3bt6 A: [172824]
    Other proteins in same PDB: d3bt6b_
    automated match to d2fk0a1
    complexed with nag, ndg, so4

Details for d3bt6a_

PDB Entry: 3bt6 (more details), 2.8 Å

PDB Description: crystal structure of influenza b virus hemagglutinin
PDB Compounds: (A:) Influenza B hemagglutinin (HA)

SCOPe Domain Sequences for d3bt6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bt6a_ b.19.1.2 (A:) Hemagglutinin {Influenza b virus}
drictgitssnsphvvktatqgevnvtgvipltttptkshfanlkgtqtrgklcpnclnc
tdldvalgrpkcmgtipsakasilhevkpvtsgcfpimhdrtkirqlpnllrgyenirls
arnvtnaetapggpyivgtsgscpnvtngngffatmawavpknktatnpltvevpyictk
gedqitvwgfhsddetqmvklygdskpqkftssangvtthyvsqiggfpnqaedeglpqs
grivvdymvqkpgktgtiayqrgvllpqkvwcasgrskvikgslpligeadclhekyggl
nkskpyytgehakaigncpiwvktplklangtkyrppakllk

SCOPe Domain Coordinates for d3bt6a_:

Click to download the PDB-style file with coordinates for d3bt6a_.
(The format of our PDB-style files is described here.)

Timeline for d3bt6a_: