SCOPe 2.01: Domain d3bt0a_: 3bt0 A:

Lineage for d3bt0a_ (3bt0 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)

6. Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
   sandwich; 8 strands in 2 sheets

7. Species Human (Homo sapiens) [TaxId:9606] [49475] (141 PDB entries)
   Uniprot P02766 31-143

8. Domain d3bt0a_: 3bt0 A: [172822]
   automated match to d1eta1_

Details for d3bt0a_

PDB Entry: 3bt0, 1.59 Å

PDB Description: crystal structure of transthyretin variant v20s

PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d3bt0a_:

Sequence; same for both SEQRES and ATOM records:

>d3bt0a_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldasrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

Timeline for d3bt0a_:

• d3bt0a_ is new in SCOPe 2.01-stable
  
• d3bt0a_ appears in SCOPe 2.02
  
• d3bt0a_ appears in the current release, SCOPe 2.08