SCOPe 2.07: Domain d3bsuh1: 3bsu H:27-72

Lineage for d3bsuh1 (3bsu H:27-72)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.1: L9 N-domain-like [55658] (3 families)

5. Family d.100.1.0: automated matches [191537] (1 protein)
   not a true family

6. Protein automated matches [190913] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188388] (1 PDB entry)

8. Domain d3bsuh1: 3bsu H:27-72 [172821]
   Other proteins in same PDB: d3bsua2, d3bsub2, d3bsuf2, d3bsuh2
   automated match to d1qhka_
   protein/DNA complex; protein/RNA complex; complexed with mg

Details for d3bsuh1

PDB Entry: 3bsu, 2.1 Å

PDB Description: Hybrid-binding domain of human RNase H1 in complex with 12-mer RNA/DNA

PDB Compounds: (H:) Ribonuclease H1

SCOPe Domain Sequences for d3bsuh1:

Sequence; same for both SEQRES and ATOM records:

>d3bsuh1 d.100.1.0 (H:27-72) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mfyavrrgrktgvfltwnecraqvdrfpaarfkkfatedeawafvr

Timeline for d3bsuh1:

• d3bsuh1 first appeared in SCOPe 2.01, called d3bsuh_
  
• d3bsuh1 appears in SCOPe 2.06
  
• d3bsuh1 appears in the current release, SCOPe 2.08