Lineage for d3bsqb_ (3bsq B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 952974Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 952975Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 954996Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 954997Protein automated matches [190438] (10 species)
    not a true protein
  7. 955000Species Human (Homo sapiens) [TaxId:9606] [187421] (15 PDB entries)
  8. 955018Domain d3bsqb_: 3bsq B: [172814]
    automated match to d1npma_
    complexed with so4

Details for d3bsqb_

PDB Entry: 3bsq (more details), 2.8 Å

PDB Description: Crystal structure of human kallikrein 7 produced as a secretion protein in E.coli
PDB Compounds: (B:) Kallikrein-7

SCOPe Domain Sequences for d3bsqb_:

Sequence, based on SEQRES records: (download)

>d3bsqb_ b.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iidgapcargshpwqvallsgnqlhcggvlvnerwvltaahckmneytvhlgsdtlgdrr
aqrikasksfrhpgystqthvndlmlvklnsqarlssmvkkvrlpsrceppgttctvsgw
gtttspdvtfpsdlmcvdvklispqdctkvykdllensmlcagipdskknacngdsggpl
vcrgtlqglvswgtfpcgqpndpgvytqvckftkwindtmkh

Sequence, based on observed residues (ATOM records): (download)

>d3bsqb_ b.47.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iidgapcargshpwqvallsgnqlhcggvlvnerwvltaahckmneytvhlgsdtlgdrr
aqrikasksfrhpgystqthvndlmlvklnsqarlssmvkkvrlpsrceppgttctvsgw
gtttspdvtfpsdlmcvdvklispqdctkvykdllensmlcagipdskknacngdsggpl
vcrgtlqglvsgtfpcgqpndpgvytqvckftkwindtmkh

SCOPe Domain Coordinates for d3bsqb_:

Click to download the PDB-style file with coordinates for d3bsqb_.
(The format of our PDB-style files is described here.)

Timeline for d3bsqb_: