Lineage for d1ak8__ (1ak8 -)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537532Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 537533Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 537713Family a.39.1.5: Calmodulin-like [47502] (23 proteins)
    Duplication: made with two pairs of EF-hands
  6. 537759Protein Calmodulin [47516] (10 species)
  7. 537783Species Cow (Bos taurus) [TaxId:9913] [47518] (17 PDB entries)
  8. 537804Domain d1ak8__: 1ak8 - [17281]
    N-terminal domain
    complexed with ce

Details for d1ak8__

PDB Entry: 1ak8 (more details)

PDB Description: nmr solution structure of cerium-loaded calmodulin amino-terminal domain (ce2-tr1c), 23 structures

SCOP Domain Sequences for d1ak8__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ak8__ a.39.1.5 (-) Calmodulin {Cow (Bos taurus)}
madqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadg
ngtidfpefltmmark

SCOP Domain Coordinates for d1ak8__:

Click to download the PDB-style file with coordinates for d1ak8__.
(The format of our PDB-style files is described here.)

Timeline for d1ak8__: