![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
![]() | Protein automated matches [190896] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188315] (4 PDB entries) |
![]() | Domain d3bs9b_: 3bs9 B: [172806] automated match to d1x5sa1 complexed with iod |
PDB Entry: 3bs9 (more details), 1.95 Å
SCOPe Domain Sequences for d3bs9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bs9b_ d.58.7.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} hfhvfvgdlspeittaaiaaafapfgrisdarvvkdmatgkskgygfvsffnkwdaenai qqmggqwlggrqirtnwat
Timeline for d3bs9b_: