| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
| Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins) oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus binds a bilin chromophore automatically mapped to Pfam PF00502 |
| Protein automated matches [190531] (23 species) not a true protein |
| Species Red algae (Galdieria sulphuraria) [TaxId:130081] [188789] (2 PDB entries) |
| Domain d3brpb_: 3brp B: [172802] automated match to d1phnb_ complexed with bla |
PDB Entry: 3brp (more details), 1.85 Å
SCOPe Domain Sequences for d3brpb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3brpb_ a.1.1.3 (B:) automated matches {Red algae (Galdieria sulphuraria) [TaxId: 130081]}
ldafakvvaqadargeflsntqldalskmvsegnkrldvvnritsnasaivtnaaralfs
eqpqliqpggnaytnrrmaaclrdmeiilryvsyaiiagdssvlddrclnglretyqalg
vpgasvavgvekmkdsaiaiandpsgittgdcsalmaevgtyfdraatav
Timeline for d3brpb_: