Lineage for d3brpa_ (3brp A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2688849Family a.1.1.3: Phycocyanin-like phycobilisome proteins [46532] (7 proteins)
    oligomers of two different types of globin-like subunits containing two extra helices at the N-terminus
    binds a bilin chromophore
    automatically mapped to Pfam PF00502
  6. 2689048Protein automated matches [190531] (23 species)
    not a true protein
  7. 2689294Species Red algae (Galdieria sulphuraria) [TaxId:130081] [188789] (2 PDB entries)
  8. 2689297Domain d3brpa_: 3brp A: [172801]
    automated match to d1phna_
    complexed with bla

Details for d3brpa_

PDB Entry: 3brp (more details), 1.85 Å

PDB Description: crystal structure of c-phycocyanin from galdieria sulphuraria
PDB Compounds: (A:) C-phycocyanin alpha chain

SCOPe Domain Sequences for d3brpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3brpa_ a.1.1.3 (A:) automated matches {Red algae (Galdieria sulphuraria) [TaxId: 130081]}
ktpiteaiaaadnqgrflsntelqavngryqraaasleaarsltsnaqrlingaaqavys
kfpytsqmpgpqyassavgkakcardigyylrmvtyclvvggtgpmdeyliagleeinrt
fdlspswyvealnyvksnhglsgqaaneantyidyaina

SCOPe Domain Coordinates for d3brpa_:

Click to download the PDB-style file with coordinates for d3brpa_.
(The format of our PDB-style files is described here.)

Timeline for d3brpa_: