Lineage for d3brla_ (3brl A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2551753Fold d.39: DLC [54647] (1 superfamily)
    core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342
  4. 2551754Superfamily d.39.1: DLC [54648] (1 family) (S)
    automatically mapped to Pfam PF01221
  5. 2551755Family d.39.1.1: DLC [54649] (3 proteins)
    8 kDa dynein light chain, DLC8
  6. 2551804Protein automated matches [190350] (4 species)
    not a true protein
  7. 2551805Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187176] (1 PDB entry)
  8. 2551806Domain d3brla_: 3brl A: [172800]
    automated match to d1rhwa_

Details for d3brla_

PDB Entry: 3brl (more details), 1.9 Å

PDB Description: crystal structure of lc8 s88e / swa
PDB Compounds: (A:) Dynein light chain 1, cytoplasmic

SCOPe Domain Sequences for d3brla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3brla_ d.39.1.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
sdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrn
fgsyvthetrhfiyfylgqvaillfkeg

SCOPe Domain Coordinates for d3brla_:

Click to download the PDB-style file with coordinates for d3brla_.
(The format of our PDB-style files is described here.)

Timeline for d3brla_: