Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.39: DLC [54647] (1 superfamily) core: beta-alpha(2)-beta-X-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 1342 |
Superfamily d.39.1: DLC [54648] (1 family) automatically mapped to Pfam PF01221 |
Family d.39.1.1: DLC [54649] (3 proteins) 8 kDa dynein light chain, DLC8 |
Protein automated matches [190350] (4 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [187176] (1 PDB entry) |
Domain d3brla_: 3brl A: [172800] automated match to d1rhwa_ |
PDB Entry: 3brl (more details), 1.9 Å
SCOPe Domain Sequences for d3brla_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3brla_ d.39.1.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} sdrkaviknadmseemqqdavdcatqalekyniekdiaayikkefdkkynptwhcivgrn fgsyvthetrhfiyfylgqvaillfkeg
Timeline for d3brla_: