SCOPe 2.05: Domain d3bqqc_: 3bqq C:

Lineage for d3bqqc_ (3bqq C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.64: Saposin-like [47861] (2 superfamilies)
   5 helices; folded leaf, closed

4. Superfamily a.64.1: Saposin [47862] (5 families)
   Lipid-binding can promote conformational changes and oligomerisation in some members

5. Family a.64.1.1: NKL-like [47863] (4 proteins)

6. Protein Saposin C [89077] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89078] (11 PDB entries)

8. Domain d3bqqc_: 3bqq C: [172792]
   automated match to d2gtga1

Details for d3bqqc_

PDB Entry: 3bqq, 2 Å

PDB Description: Crystal Structure of Human Saposin D (triclinic)

PDB Compounds: (C:) Proactivator polypeptide

SCOPe Domain Sequences for d3bqqc_:

Sequence; same for both SEQRES and ATOM records:

>d3bqqc_ a.64.1.1 (C:) Saposin C {Human (Homo sapiens) [TaxId: 9606]}
dggfcevckklvgyldrnleknstkqeilaalekgcsflpdpyqkqcdqfvaeyepvlie
ilvevmdpsfvclkigacp

Timeline for d3bqqc_:

• d3bqqc_ first appeared in SCOPe 2.01
  
• d3bqqc_ appears in SCOPe 2.04
  
• d3bqqc_ appears in SCOPe 2.06
  
• d3bqqc_ appears in the current release, SCOPe 2.08