Lineage for d3bqpa_ (3bqp A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1738873Fold a.64: Saposin-like [47861] (2 superfamilies)
    5 helices; folded leaf, closed
  4. 1738874Superfamily a.64.1: Saposin [47862] (5 families) (S)
    Lipid-binding can promote conformational changes and oligomerisation in some members
  5. 1738929Family a.64.1.0: automated matches [191532] (1 protein)
    not a true family
  6. 1738930Protein automated matches [190901] (1 species)
    not a true protein
  7. 1738931Species Human (Homo sapiens) [TaxId:9606] [188335] (1 PDB entry)
  8. 1738932Domain d3bqpa_: 3bqp A: [172788]
    automated match to d2gtga1
    complexed with mg

Details for d3bqpa_

PDB Entry: 3bqp (more details), 1.3 Å

PDB Description: Crystal Structure of Human Saposin D (orthorhombic)
PDB Compounds: (A:) Proactivator polypeptide

SCOPe Domain Sequences for d3bqpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bqpa_ a.64.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dggfcevckklvgyldrnleknstkqeilaalekgcsflpdpyqkqcdqfvaeyepvlie
ilvevmdpsfvclkigacps

SCOPe Domain Coordinates for d3bqpa_:

Click to download the PDB-style file with coordinates for d3bqpa_.
(The format of our PDB-style files is described here.)

Timeline for d3bqpa_: