![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.64: Saposin-like [47861] (2 superfamilies) 5 helices; folded leaf, closed |
![]() | Superfamily a.64.1: Saposin [47862] (5 families) ![]() Lipid-binding can promote conformational changes and oligomerisation in some members |
![]() | Family a.64.1.0: automated matches [191532] (1 protein) not a true family |
![]() | Protein automated matches [190901] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188335] (1 PDB entry) |
![]() | Domain d3bqpa_: 3bqp A: [172788] automated match to d2gtga1 complexed with mg |
PDB Entry: 3bqp (more details), 1.3 Å
SCOPe Domain Sequences for d3bqpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bqpa_ a.64.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} dggfcevckklvgyldrnleknstkqeilaalekgcsflpdpyqkqcdqfvaeyepvlie ilvevmdpsfvclkigacps
Timeline for d3bqpa_: