SCOPe 2.08: Domain d3bq7d_: 3bq7 D:

Lineage for d3bq7d_ (3bq7 D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (24 PDB entries)

8. Domain d3bq7d_: 3bq7 D: [172785]
   Other proteins in same PDB: d3bq7a2, d3bq7c2, d3bq7e2
   automated match to d2f3na1

Details for d3bq7d_

PDB Entry: 3bq7, 2.9 Å

PDB Description: sam domain of diacylglycerol kinase delta1 (e35g)

PDB Compounds: (D:) Diacylglycerol kinase delta

SCOPe Domain Sequences for d3bq7d_:

Sequence; same for both SEQRES and ATOM records:

>d3bq7d_ a.60.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pvhlwgteevaawlehlslceykdiftrhdirgsgllhlerrdlkdlgvtkvghmkrilc
gikelsrs

Timeline for d3bq7d_:

• d3bq7d_ first appeared in SCOPe 2.01
  
• d3bq7d_ appears in SCOPe 2.07