SCOPe 2.07: Domain d3bpzd_: 3bpz D:

Lineage for d3bpzd_ (3bpz D:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein HCN pacemaker channel [101993] (1 species)
   potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel

7. Species Mouse (Mus musculus) [TaxId:10090] [101994] (10 PDB entries)

8. Domain d3bpzd_: 3bpz D: [172781]
   automated match to d1q5oa_
   complexed with cmp

Details for d3bpzd_

PDB Entry: 3bpz, 1.65 Å

PDB Description: hcn2-i 443-460 e502k in the presence of camp

PDB Compounds: (D:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2

SCOPe Domain Sequences for d3bpzd_:

Sequence; same for both SEQRES and ATOM records:

>d3bpzd_ b.82.3.2 (D:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplrek
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaidrldri

Timeline for d3bpzd_:

• d3bpzd_ first appeared in SCOPe 2.01
  
• d3bpzd_ appears in SCOPe 2.06
  
• d3bpzd_ appears in the current release, SCOPe 2.08