SCOPe 2.01: Domain d3bpwb_: 3bpw B:

Lineage for d3bpwb_ (3bpw B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.3: Decarboxylase [51375] (4 proteins)

6. Protein Protozoan orotidine monophosphate decarboxylase [141749] (5 species)

7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141751] (1 PDB entry)
   Uniprot Q8T6J6 1-323

8. Domain d3bpwb_: 3bpw B: [172777]
   automated match to d2f84a1
   complexed with peg, po4, xmp

Details for d3bpwb_

PDB Entry: 3bpw, 1.7 Å

PDB Description: Crystal Structure of P. falciparum Orotidine 5'-monophosphate Decarboxylase Complexed with XMP

PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3bpwb_:

Sequence; same for both SEQRES and ATOM records:

>d3bpwb_ c.1.2.3 (B:) Protozoan orotidine monophosphate decarboxylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
smgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsik
kdillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvl
knvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyd
eeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigf
vvgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitkn
pypqkaaqmyydqinailkqn

Timeline for d3bpwb_:

• d3bpwb_ is new in SCOPe 2.01-stable
  
• d3bpwb_ appears in SCOPe 2.02
  
• d3bpwb_ appears in the current release, SCOPe 2.08, called d3bpwb1