SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3bpwb1 (3bpw B:1-320)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079148Family c.1.2.3: Decarboxylase [51375] (4 protein domains)
  6. 2079267Protein Protozoan orotidine monophosphate decarboxylase [141749] (5 species)
  7. 2079268Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141751] (2 PDB entries)
    Uniprot Q8T6J6 1-323
  8. 2079270Domain d3bpwb1: 3bpw B:1-320 [172777]
    Other proteins in same PDB: d3bpwa2, d3bpwb2
    automated match to d2f84a1
    complexed with peg, po4, xmp

Details for d3bpwb1

PDB Entry: 3bpw (more details), 1.7 Å

PDB Description: Crystal Structure of P. falciparum Orotidine 5'-monophosphate Decarboxylase Complexed with XMP
PDB Compounds: (B:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3bpwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bpwb1 c.1.2.3 (B:1-320) Protozoan orotidine monophosphate decarboxylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikk
dillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlk
nvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicyde
eknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqnnefigfv
vgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinigraitknp
ypqkaaqmyydqinailkqn

SCOPe Domain Coordinates for d3bpwb1:

Click to download the PDB-style file with coordinates for d3bpwb1.
(The format of our PDB-style files is described here.)

Timeline for d3bpwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bpwb2