Lineage for d3bpwa_ (3bpw A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1815757Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 1815849Family c.1.2.3: Decarboxylase [51375] (4 proteins)
  6. 1815968Protein Protozoan orotidine monophosphate decarboxylase [141749] (5 species)
  7. 1815969Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [141751] (2 PDB entries)
    Uniprot Q8T6J6 1-323
  8. 1815970Domain d3bpwa_: 3bpw A: [172776]
    automated match to d2f84a1
    complexed with peg, po4, xmp

Details for d3bpwa_

PDB Entry: 3bpw (more details), 1.7 Å

PDB Description: Crystal Structure of P. falciparum Orotidine 5'-monophosphate Decarboxylase Complexed with XMP
PDB Compounds: (A:) orotidine 5'-phosphate decarboxylase

SCOPe Domain Sequences for d3bpwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bpwa_ c.1.2.3 (A:) Protozoan orotidine monophosphate decarboxylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
glvprgsmgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyi
nnvsikkdillkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygs
vgidvlknvfdylyelniptildmkindigntvknyrkfifeylksdsctvniymgtnml
kdicydeeknkyysafvlvkttnpdsaifqknlsldnkqayvimaqealnmssylnleqn
nefigfvvgansydemnyirtyfpncyilspgigaqngdlhktltngyhksyekilinig
raitknpypqkaaqmyydqinailkqnmes

SCOPe Domain Coordinates for d3bpwa_:

Click to download the PDB-style file with coordinates for d3bpwa_.
(The format of our PDB-style files is described here.)

Timeline for d3bpwa_: