![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
![]() | Superfamily b.36.1: PDZ domain-like [50156] (7 families) ![]() peptide-binding domain |
![]() | Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
![]() | Protein automated matches [190436] (8 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187333] (103 PDB entries) |
![]() | Domain d3bpua1: 3bpu A:640-721 [172775] Other proteins in same PDB: d3bpua2, d3bpua3 automated match to d1ujva_ complexed with zn; mutant |
PDB Entry: 3bpu (more details), 1.6 Å
SCOPe Domain Sequences for d3bpua1:
Sequence, based on SEQRES records: (download)
>d3bpua1 b.36.1.0 (A:640-721) automated matches {Human (Homo sapiens) [TaxId: 9606]} elitvhivkgpmgfgftiadspggggqrvkqivdsprsrglkegdlivevnkknvqalth nqvvdmlvespkgsevtllvqr
>d3bpua1 b.36.1.0 (A:640-721) automated matches {Human (Homo sapiens) [TaxId: 9606]} elitvhivkgpmgfgftiadspggggqrvkqivdrsrglkegdlivevnkknvqalthnq vvdmlvespkgsevtllvqr
Timeline for d3bpua1: