Lineage for d3bpka1 (3bpk A:1-199)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055232Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2055233Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2055435Family b.45.1.0: automated matches [191365] (1 protein)
    not a true family
  6. 2055436Protein automated matches [190439] (20 species)
    not a true protein
  7. 2055441Species Bacillus cereus [TaxId:226900] [188294] (1 PDB entry)
  8. 2055442Domain d3bpka1: 3bpk A:1-199 [172771]
    Other proteins in same PDB: d3bpka2, d3bpkb2
    automated match to d1ejea_
    complexed with cl, so4

Details for d3bpka1

PDB Entry: 3bpk (more details), 1.56 Å

PDB Description: crystal structure of nitrilotriacetate monooxygenase component b from bacillus cereus
PDB Compounds: (A:) Nitrilotriacetate monooxygenase component B

SCOPe Domain Sequences for d3bpka1:

Sequence, based on SEQRES records: (download)

>d3bpka1 b.45.1.0 (A:1-199) automated matches {Bacillus cereus [TaxId: 226900]}
mlsinpneqtekdnyklltgsiiprpvafvtsvtkegvlngapysyfnivaanpplisvs
vqrkagerkdtsrnaiekgefvvhisdesyvaainetaanlppneseielakltpiesev
isvpgvkeanirmecvleraiplggtedspacdlligrvvrfhvaehlyekgrihaeglk
pisrlaghnyaklgeqfel

Sequence, based on observed residues (ATOM records): (download)

>d3bpka1 b.45.1.0 (A:1-199) automated matches {Bacillus cereus [TaxId: 226900]}
mlsinpneqtekdnyklltgsiiprpvafvtsvtkegvlngapysyfnivaanpplisvs
vqrkagerkdtsrnaiekgefvvhisdesyvaainetaaneseielakltpiesevisvp
gvkeanirmecvleraiplggtedspacdlligrvvrfhvaehlyekgrihaeglkpisr
laghnyaklgeqfel

SCOPe Domain Coordinates for d3bpka1:

Click to download the PDB-style file with coordinates for d3bpka1.
(The format of our PDB-style files is described here.)

Timeline for d3bpka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3bpka2