Lineage for d3bpfc_ (3bpf C:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1014844Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 1014845Superfamily d.3.1: Cysteine proteinases [54001] (23 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 1014846Family d.3.1.1: Papain-like [54002] (26 proteins)
  6. 1015065Protein Falcipain 2 [142846] (1 species)
  7. 1015066Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [142847] (4 PDB entries)
    Uniprot Q9N6S8 244-484
  8. 1015075Domain d3bpfc_: 3bpf C: [172769]
    automated match to d1yvba1
    complexed with e64, gol

Details for d3bpfc_

PDB Entry: 3bpf (more details), 2.9 Å

PDB Description: Crystal Structure of Falcipain-2 with Its inhibitor, E64
PDB Compounds: (C:) Cysteine protease falcipain-2

SCOPe Domain Sequences for d3bpfc_:

Sequence, based on SEQRES records: (download)

>d3bpfc_ d.3.1.1 (C:) Falcipain 2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mnyeevikkyrgeenfdhaaydwrlhsgvtpvkdqkncgscwafssigsvesqyairknk
litlseqelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrcte
kygiknylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvgf
gmkeivnpltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafiplie

Sequence, based on observed residues (ATOM records): (download)

>d3bpfc_ d.3.1.1 (C:) Falcipain 2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mnyeevikkydhaaydwrlhsgvtpvkdqkncgscwafssigsvesqyairknklitlse
qelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrctekygikn
ylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvgfgmkeiv
npltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafiplie

SCOPe Domain Coordinates for d3bpfc_:

Click to download the PDB-style file with coordinates for d3bpfc_.
(The format of our PDB-style files is described here.)

Timeline for d3bpfc_: