SCOPe 2.06: Domain d3bpbb_: 3bpb B:

Lineage for d3bpbb_ (3bpb B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
   duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis

4. Superfamily d.126.1: Pentein [55909] (8 families)

5. Family d.126.1.3: Dimethylarginine dimethylaminohydrolase DDAH [64380] (1 protein)
   functionally related to the amidinotransferase, similar active sites
   automatically mapped to Pfam PF02274

6. Protein Dimethylarginine dimethylaminohydrolase DDAH [64381] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [64382] (3 PDB entries)

8. Domain d3bpbb_: 3bpb B: [172766]
   automated match to d1h70a_
   complexed with smz

Details for d3bpbb_

PDB Entry: 3bpb, 2.81 Å

PDB Description: crystal structure of the dimethylarginine dimethylaminohydrolase h162g adduct with s-methyl-l-thiocitrulline

PDB Compounds: (B:) dimethylarginine dimethylaminohydrolase

SCOPe Domain Sequences for d3bpbb_:

Sequence; same for both SEQRES and ATOM records:

>d3bpbb_ d.126.1.3 (B:) Dimethylarginine dimethylaminohydrolase DDAH {Pseudomonas aeruginosa [TaxId: 287]}
mfkhiiartparslvdgltsshlgkpdyakaleqhnayiralqtcdvditllppderfpd
svfvedpvlctsrcaiitrpgaesrrgeteiieetvqrfypgkverieapgtveagdimm
vgdhfyigesartnaegarqmiailekhglsgsvvrlekvlglktglaylehnnllaage
fvskpefqdfniieipeeesyaanciwvnervimpagyprtrekiarlgyrvievdtsey
rkidggvscmslrf

Timeline for d3bpbb_:

• d3bpbb_ first appeared in SCOPe 2.01
  
• d3bpbb_ appears in SCOPe 2.05
  
• d3bpbb_ appears in SCOPe 2.07
  
• d3bpbb_ appears in the current release, SCOPe 2.08