Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily) duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis |
Superfamily d.126.1: Pentein [55909] (8 families) |
Family d.126.1.3: Dimethylarginine dimethylaminohydrolase DDAH [64380] (1 protein) functionally related to the amidinotransferase, similar active sites automatically mapped to Pfam PF02274 |
Protein Dimethylarginine dimethylaminohydrolase DDAH [64381] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [64382] (3 PDB entries) |
Domain d3bpbb_: 3bpb B: [172766] automated match to d1h70a_ complexed with smz |
PDB Entry: 3bpb (more details), 2.81 Å
SCOPe Domain Sequences for d3bpbb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bpbb_ d.126.1.3 (B:) Dimethylarginine dimethylaminohydrolase DDAH {Pseudomonas aeruginosa [TaxId: 287]} mfkhiiartparslvdgltsshlgkpdyakaleqhnayiralqtcdvditllppderfpd svfvedpvlctsrcaiitrpgaesrrgeteiieetvqrfypgkverieapgtveagdimm vgdhfyigesartnaegarqmiailekhglsgsvvrlekvlglktglaylehnnllaage fvskpefqdfniieipeeesyaanciwvnervimpagyprtrekiarlgyrvievdtsey rkidggvscmslrf
Timeline for d3bpbb_: