Lineage for d3bpbb_ (3bpb B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1217588Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 1217589Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 1217615Family d.126.1.3: Dimethylarginine dimethylaminohydrolase DDAH [64380] (1 protein)
    functionally related to the amidinotransferase, similar active sites
  6. 1217616Protein Dimethylarginine dimethylaminohydrolase DDAH [64381] (1 species)
  7. 1217617Species Pseudomonas aeruginosa [TaxId:287] [64382] (3 PDB entries)
  8. 1217622Domain d3bpbb_: 3bpb B: [172766]
    automated match to d1h70a_
    complexed with smz

Details for d3bpbb_

PDB Entry: 3bpb (more details), 2.81 Å

PDB Description: crystal structure of the dimethylarginine dimethylaminohydrolase h162g adduct with s-methyl-l-thiocitrulline
PDB Compounds: (B:) dimethylarginine dimethylaminohydrolase

SCOPe Domain Sequences for d3bpbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bpbb_ d.126.1.3 (B:) Dimethylarginine dimethylaminohydrolase DDAH {Pseudomonas aeruginosa [TaxId: 287]}
mfkhiiartparslvdgltsshlgkpdyakaleqhnayiralqtcdvditllppderfpd
svfvedpvlctsrcaiitrpgaesrrgeteiieetvqrfypgkverieapgtveagdimm
vgdhfyigesartnaegarqmiailekhglsgsvvrlekvlglktglaylehnnllaage
fvskpefqdfniieipeeesyaanciwvnervimpagyprtrekiarlgyrvievdtsey
rkidggvscmslrf

SCOPe Domain Coordinates for d3bpbb_:

Click to download the PDB-style file with coordinates for d3bpbb_.
(The format of our PDB-style files is described here.)

Timeline for d3bpbb_: