Lineage for d3bpba_ (3bpb A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2213803Fold d.126: Pentein, beta/alpha-propeller [55908] (1 superfamily)
    duplication: composed of 5 alpha-beta(2)-alpha-beta units arranged around pseudo fivefold axis
  4. 2213804Superfamily d.126.1: Pentein [55909] (8 families) (S)
  5. 2213833Family d.126.1.3: Dimethylarginine dimethylaminohydrolase DDAH [64380] (1 protein)
    functionally related to the amidinotransferase, similar active sites
    automatically mapped to Pfam PF02274
  6. 2213834Protein Dimethylarginine dimethylaminohydrolase DDAH [64381] (1 species)
  7. 2213835Species Pseudomonas aeruginosa [TaxId:287] [64382] (3 PDB entries)
  8. 2213839Domain d3bpba_: 3bpb A: [172765]
    automated match to d1h70a_
    complexed with smz

Details for d3bpba_

PDB Entry: 3bpb (more details), 2.81 Å

PDB Description: crystal structure of the dimethylarginine dimethylaminohydrolase h162g adduct with s-methyl-l-thiocitrulline
PDB Compounds: (A:) dimethylarginine dimethylaminohydrolase

SCOPe Domain Sequences for d3bpba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bpba_ d.126.1.3 (A:) Dimethylarginine dimethylaminohydrolase DDAH {Pseudomonas aeruginosa [TaxId: 287]}
mfkhiiartparslvdgltsshlgkpdyakaleqhnayiralqtcdvditllppderfpd
svfvedpvlctsrcaiitrpgaesrrgeteiieetvqrfypgkverieapgtveagdimm
vgdhfyigesartnaegarqmiailekhglsgsvvrlekvlglktglaylehnnllaage
fvskpefqdfniieipeeesyaanciwvnervimpagyprtrekiarlgyrvievdtsey
rkidggvscmslrf

SCOPe Domain Coordinates for d3bpba_:

Click to download the PDB-style file with coordinates for d3bpba_.
(The format of our PDB-style files is described here.)

Timeline for d3bpba_: