Lineage for d3bp9t_ (3bp9 T:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2717816Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 2717817Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 2717818Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 2717819Protein AKV capsid [116949] (2 species)
  7. 2717827Species Murine leukemia virus [TaxId:11786] [188334] (1 PDB entry)
  8. 2717847Domain d3bp9t_: 3bp9 T: [172760]
    automated match to d1u7ka_
    complexed with gol, ipa

Details for d3bp9t_

PDB Entry: 3bp9 (more details), 2.6 Å

PDB Description: Structure of B-tropic MLV capsid N-terminal domain
PDB Compounds: (T:) gag protein

SCOPe Domain Sequences for d3bp9t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bp9t_ a.73.1.1 (T:) AKV capsid {Murine leukemia virus [TaxId: 11786]}
plrlggngqlqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllg
tlltgeekqrvllearkavrgndgrptqlpnevdaafplerpdwdytttegrnhlvlyrq
lllaglqnagrs

SCOPe Domain Coordinates for d3bp9t_:

Click to download the PDB-style file with coordinates for d3bp9t_.
(The format of our PDB-style files is described here.)

Timeline for d3bp9t_: