![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
![]() | Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) ![]() |
![]() | Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
![]() | Protein AKV capsid [116949] (2 species) |
![]() | Species Murine leukemia virus [TaxId:11786] [188334] (1 PDB entry) |
![]() | Domain d3bp9m_: 3bp9 M: [172753] automated match to d1u7ka_ complexed with gol, ipa |
PDB Entry: 3bp9 (more details), 2.6 Å
SCOPe Domain Sequences for d3bp9m_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bp9m_ a.73.1.1 (M:) AKV capsid {Murine leukemia virus [TaxId: 11786]} plrlggngqlqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllg tlltgeekqrvllearkavrgndgrptqlpnevdaafplerpdwdytttegrnhlvlyrq lllaglqnagrs
Timeline for d3bp9m_: