Class a: All alpha proteins [46456] (284 folds) |
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) |
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
Protein AKV capsid [116949] (2 species) |
Species Murine leukemia virus [TaxId:11786] [188334] (1 PDB entry) |
Domain d3bp9k_: 3bp9 K: [172751] automated match to d1u7ka_ complexed with gol, ipa |
PDB Entry: 3bp9 (more details), 2.6 Å
SCOPe Domain Sequences for d3bp9k_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bp9k_ a.73.1.1 (K:) AKV capsid {Murine leukemia virus [TaxId: 11786]} plrlggngqlqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllg tlltgeekqrvllearkavrgndgrptqlpnevdaafplerpdwdytttegrnhlvlyrq lllaglqnagr
Timeline for d3bp9k_: