SCOPe 2.06: Domain d3bp9i_: 3bp9 I:

Lineage for d3bp9i_ (3bp9 I:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein AKV capsid [116949] (2 species)

7. Species Murine leukemia virus [TaxId:11786] [188334] (1 PDB entry)

8. Domain d3bp9i_: 3bp9 I: [172749]
   automated match to d1u7ka_
   complexed with gol, ipa

Details for d3bp9i_

PDB Entry: 3bp9, 2.6 Å

PDB Description: Structure of B-tropic MLV capsid N-terminal domain

PDB Compounds: (I:) gag protein

SCOPe Domain Sequences for d3bp9i_:

Sequence; same for both SEQRES and ATOM records:

>d3bp9i_ a.73.1.1 (I:) AKV capsid {Murine leukemia virus [TaxId: 11786]}
plrlggngqlqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllg
tlltgeekqrvllearkavrgndgrptqlpnevdaafplerpdwdytttegrnhlvlyrq
lllaglqnagr

Timeline for d3bp9i_:

• d3bp9i_ first appeared in SCOPe 2.01
  
• d3bp9i_ appears in SCOPe 2.05
  
• d3bp9i_ appears in SCOPe 2.07
  
• d3bp9i_ appears in the current release, SCOPe 2.08