Lineage for d3bp9d_ (3bp9 D:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 918184Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 918185Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) (S)
  5. 918186Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 918187Protein AKV capsid [116949] (2 species)
  7. 918195Species Murine leukemia virus [TaxId:11786] [188334] (1 PDB entry)
  8. 918199Domain d3bp9d_: 3bp9 D: [172744]
    automated match to d1u7ka_
    complexed with gol, ipa

Details for d3bp9d_

PDB Entry: 3bp9 (more details), 2.6 Å

PDB Description: Structure of B-tropic MLV capsid N-terminal domain
PDB Compounds: (D:) gag protein

SCOPe Domain Sequences for d3bp9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bp9d_ a.73.1.1 (D:) AKV capsid {Murine leukemia virus [TaxId: 11786]}
plrlggngqlqywpfsssdlynwknnnpsfsedpgkltaliesvltthqptwddcqqllg
tlltgeekqrvllearkavrgndgrptqlpnevdaafplerpdwdytttegrnhlvlyrq
lllaglqnagr

SCOPe Domain Coordinates for d3bp9d_:

Click to download the PDB-style file with coordinates for d3bp9d_.
(The format of our PDB-style files is described here.)

Timeline for d3bp9d_: