Lineage for d3bp6a_ (3bp6 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1757735Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species)
  7. 1757739Species Mouse (Mus musculus) [TaxId:10090] [101511] (5 PDB entries)
  8. 1757740Domain d3bp6a_: 3bp6 A: [172739]
    automated match to d1npua_
    complexed with gol; mutant

Details for d3bp6a_

PDB Entry: 3bp6 (more details), 1.6 Å

PDB Description: crystal structure of the mouse pd-1 mutant and pd-l2 complex
PDB Compounds: (A:) Programmed cell death protein 1

SCOPe Domain Sequences for d3bp6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bp6a_ b.1.1.1 (A:) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]}
sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda
rfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpklkieespgaelvvt

SCOPe Domain Coordinates for d3bp6a_:

Click to download the PDB-style file with coordinates for d3bp6a_.
(The format of our PDB-style files is described here.)

Timeline for d3bp6a_: