Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein Programmed cell death protein 1, PD1, extracellular domain [101510] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [101511] (5 PDB entries) |
Domain d3bp6a_: 3bp6 A: [172739] automated match to d1npua_ complexed with gol; mutant |
PDB Entry: 3bp6 (more details), 1.6 Å
SCOPe Domain Sequences for d3bp6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bp6a_ b.1.1.1 (A:) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} sltfypawltvseganatftcslsnwsedlmlnwnrlspsnqtekqaafsnglsqpvqda rfqiiqlpnrhdfhmnildtrrndsgiylcgaislhpklkieespgaelvvt
Timeline for d3bp6a_: