SCOPe 2.06: Domain d3bp3b_: 3bp3 B:

Lineage for d3bp3b_ (3bp3 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
   alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243

4. Superfamily d.95.1: Glucose permease domain IIB [55604] (1 family)

5. Family d.95.1.1: Glucose permease domain IIB [55605] (1 protein)

6. Protein Glucose permease domain IIB [55606] (1 species)

7. Species Escherichia coli [TaxId:562] [55607] (4 PDB entries)
   there are differences in secondary structure packing between the two NMR-determined structures

8. Domain d3bp3b_: 3bp3 B: [172737]
   automated match to d1ibaa_
   complexed with so4

Details for d3bp3b_

PDB Entry: 3bp3, 1.65 Å

PDB Description: Crystal structure of EIIB

PDB Compounds: (B:) Glucose-specific phosphotransferase enzyme IIB component

SCOPe Domain Sequences for d3bp3b_:

Sequence; same for both SEQRES and ATOM records:

>d3bp3b_ d.95.1.1 (B:) Glucose permease domain IIB {Escherichia coli [TaxId: 562]}
tgtsemapalvaafggkenitnldacitrlrvsvadvskvdqaglkklgaagvvvagsgv
qaifgtksdnlktemdeyirn

Timeline for d3bp3b_:

• d3bp3b_ first appeared in SCOPe 2.01
  
• d3bp3b_ appears in SCOPe 2.05
  
• d3bp3b_ appears in SCOPe 2.07
  
• d3bp3b_ appears in the current release, SCOPe 2.08