Lineage for d3bora_ (3bor A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870646Family c.37.1.19: Tandem AAA-ATPase domain [81268] (41 proteins)
    duplication: tandem repeat of two RecA-like (AAA) domains
  6. 2870939Protein automated matches [190301] (7 species)
    not a true protein
  7. 2870951Species Human (Homo sapiens) [TaxId:9606] [187108] (5 PDB entries)
  8. 2870956Domain d3bora_: 3bor A: [172735]
    automated match to d2g9na1

Details for d3bora_

PDB Entry: 3bor (more details), 1.85 Å

PDB Description: crystal structure of the deadc domain of human translation initiation factor 4a-2
PDB Compounds: (A:) Human initiation factor 4A-II

SCOPe Domain Sequences for d3bora_:

Sequence, based on SEQRES records: (download)

>d3bora_ c.37.1.19 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivdnfddmnlkesllrgiyaygfekpsaiqqraiipcikgydviaqaqsgtgktatfai
silqqleiefketqalvlaptrelaqqiqkvilalgdymgatchaciggtnvrnemqklq
aeaphivvgtpgrvfdmlnrrylspkwikmfvldeademlsrgfkdqiyeifqklntsiq
vvllsatmptdvlevtkkfmrdpiril

Sequence, based on observed residues (ATOM records): (download)

>d3bora_ c.37.1.19 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivdnfddmnlkesllrgiyaygfekpsaiqqraiipcikgydviaqaqsgtgktatfai
silqqleiefketqalvlaptrelaqqiqkvilalgdymgatchacigeaphivvgtpgr
vfdmlnrrylspkwikmfvldeademlsrgfkdqiyeifqklntsiqvvllsatmptdvl
evtkkfmrdpiril

SCOPe Domain Coordinates for d3bora_:

Click to download the PDB-style file with coordinates for d3bora_.
(The format of our PDB-style files is described here.)

Timeline for d3bora_: