Lineage for d3bomc_ (3bom C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473136Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1475069Protein automated matches [190359] (38 species)
    not a true protein
  7. 1475328Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [188309] (2 PDB entries)
  8. 1475331Domain d3bomc_: 3bom C: [172733]
    automated match to d1outa_
    complexed with edo, hem

Details for d3bomc_

PDB Entry: 3bom (more details), 1.35 Å

PDB Description: crystal structure of trout hemoglobin at 1.35 angstrom resolution
PDB Compounds: (C:) Hemoglobin subunit alpha-4

SCOPe Domain Sequences for d3bomc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bomc_ a.1.1.2 (C:) automated matches {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
slsakdkanvkaiwgkilpksdeigeqalsrmlvvypqtkayfshwasvapgsapvkkhg
itimnqiddcvghmddlfgfltklselhatklrvdptnfkilahnlivviaayfpaeftp
eihlsvdkflqqlalalaekyr

SCOPe Domain Coordinates for d3bomc_:

Click to download the PDB-style file with coordinates for d3bomc_.
(The format of our PDB-style files is described here.)

Timeline for d3bomc_: