Lineage for d3bomb_ (3bom B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688783Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [188309] (2 PDB entries)
  8. 2688785Domain d3bomb_: 3bom B: [172732]
    automated match to d1spgb_
    complexed with edo, hem

Details for d3bomb_

PDB Entry: 3bom (more details), 1.35 Å

PDB Description: crystal structure of trout hemoglobin at 1.35 angstrom resolution
PDB Compounds: (B:) Hemoglobin subunit beta-4

SCOPe Domain Sequences for d3bomb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bomb_ a.1.1.2 (B:) automated matches {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
vdwtdaersaivglwgkisvdeigpqalarllivspwtqrhfstfgnlstpaaimgnpav
akhgktvmhgldravqnlddikntyvtlsvmhseklfvdpdnfrlladcitvcvaaklgp
avfsadtqeafqkflavvvsalgrqyh

SCOPe Domain Coordinates for d3bomb_:

Click to download the PDB-style file with coordinates for d3bomb_.
(The format of our PDB-style files is described here.)

Timeline for d3bomb_: