Lineage for d3boma_ (3bom A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1253685Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1253686Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1253759Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1255628Protein automated matches [190359] (36 species)
    not a true protein
  7. 1255875Species Rainbow trout (Oncorhynchus mykiss) [TaxId:8022] [188309] (2 PDB entries)
  8. 1255876Domain d3boma_: 3bom A: [172731]
    automated match to d1outa_
    complexed with edo, hem

Details for d3boma_

PDB Entry: 3bom (more details), 1.35 Å

PDB Description: crystal structure of trout hemoglobin at 1.35 angstrom resolution
PDB Compounds: (A:) Hemoglobin subunit alpha-4

SCOPe Domain Sequences for d3boma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3boma_ a.1.1.2 (A:) automated matches {Rainbow trout (Oncorhynchus mykiss) [TaxId: 8022]}
slsakdkanvkaiwgkilpksdeigeqalsrmlvvypqtkayfshwasvapgsapvkkhg
itimnqiddcvghmddlfgfltklselhatklrvdptnfkilahnlivviaayfpaeftp
eihlsvdkflqqlalalaekyr

SCOPe Domain Coordinates for d3boma_:

Click to download the PDB-style file with coordinates for d3boma_.
(The format of our PDB-style files is described here.)

Timeline for d3boma_: